DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss29

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:289 Identity:76/289 - (26%)
Similarity:135/289 - (46%) Gaps:40/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTAL------FAKGSYLGGG 119
            |::.|:..|.|:   |.|:..           |.|:.....::||..:|      :|...::.||
  Rat    14 SSIAGIPASVPE---DVLVGI-----------VGGNSAPQGKWPWQVSLRVYRYNWASWVHICGG 64

  Fly   120 SLITPGLVLTAAHIL--AGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGAND 182
            |:|.|..||||||.:  :...|:...:..|:..|...|||     .:|.:::.|..|..|...:|
  Rat    65 SIIHPQWVLTAAHCIHESDADPSAFRIYLGQVYLYGGEKL-----LKVSRVIIHPDFVRSGLGSD 124

  Fly   183 LALLFLDSPFELRANIQTIRL-PIPDKTFDRRICTVAGWG---MRSSTDVDIQTIQQKVDLPVVE 243
            :|||.|........|::.::| |...:...:.:|.|.|||   |..|.....:.  |:|.:.:|:
  Rat   125 VALLQLAQSVRSFPNVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRL--QQVQVKIVD 187

  Fly   244 SSKCQRQLR-LTKMGSNYQ--LPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSF 305
            ::.|::..| .|::.::.|  :...::|| |..|||.|....|..|.|::   ...:...|:||:
  Rat   188 NTLCEKLYRNATRLSNHGQRLILQDMLCA-GSHGRDSCYGDSGGPLVCNV---TGSWTLVGVVSW 248

  Fly   306 GVGCGQANVPTTFTHVSKFMEWINPHLEQ 334
            |.||...::|..:..|..|:.||...:::
  Rat   249 GYGCALKDIPGVYARVQFFLPWITGQMQK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 68/248 (27%)
Tryp_SPc 95..328 CDD:214473 67/247 (27%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.