DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG33225

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:239 Identity:71/239 - (29%)
Similarity:107/239 - (44%) Gaps:32/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKI 168
            ||:..:..:.:....|||||...|||:|..|..| |..:::  ||:|.:.: ..:....||||.|
  Fly    69 PWMVMVLGENNVFCSGSLITRLFVLTSASCLLSL-PKQVIL--GEYDRNCT-SADCTSIRQVIDI 129

  Fly   169 ME---HEAFNYSSGAN-DLALLFLDSPFELRANIQTIRLPIPDKTFDRRI--CTVAGWGMRSSTD 227
            .:   |..|...:... |:|||.|.....:...::.|.|.: |:...|.:  .|..|||.....:
  Fly   130 DQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSV-DRQVGRSVQHFTATGWGTTEWNE 193

  Fly   228 VDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCS--LFGGFALFCSL 290
            .  .||.|.|.|..:....|:.:||       ..:.||.:|.||.. :|.||  ..|..:|...:
  Fly   194 P--STILQTVTLSKINRKYCKGRLR-------QNIDASQLCVGGPR-KDTCSGDAGGPLSLTLKI 248

  Fly   291 DDDP--NRYEQA---GIVSFG-VGCGQANVPTTFTHVSKFMEWI 328
            |.|.  |...:|   ||||:| ..|....|   :|:|..:|:||
  Fly   249 DGDGKWNNKSRAFLIGIVSYGSSSCSGIGV---YTNVEHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 71/239 (30%)
Tryp_SPc 95..328 CDD:214473 69/237 (29%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 69/237 (29%)
Tryp_SPc 57..292 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.