DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG33226

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:259 Identity:72/259 - (27%)
Similarity:102/259 - (39%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWD------LSSSEKLNP--P 160
            ||:..:..:|.:..|||||:...||||||.   .|...:.||.|.:.      |.||:..:|  |
  Fly    59 PWMVQILQRGYHFCGGSLISSLFVLTAAHC---HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGP 120

  Fly   161 MDRQVIKIMEHEAF----NYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRIC------ 215
             :..|.:|..|.::    ||     |:||..|..|  :|.|:||           |.||      
  Fly   121 -EIDVKRIFLHSSYRDYHNY-----DIALFLLAKP--VRYNVQT-----------RPICVLQTSN 166

  Fly   216 --------------TVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASL 266
                          .|.|||...|...  .||.|...|..::...| .|:...|:|..:      
  Fly   167 KDKLRQFLNYVAMFNVTGWGKTESQLT--STILQTTSLFHLDRKFC-AQIFDRKIGWPH------ 222

  Fly   267 MCAGGEEGRDVCSLFGGFALFCSLD-DDPNRYEQAGIVSFGV-GCGQANVPTTFTHVSKFMEWI 328
            :|||..:. ..|:...|..|...|. ....|....||:|:|. .|.:.   |.||:|.::..||
  Fly   223 ICAGHSQS-STCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV---TVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 72/259 (28%)
Tryp_SPc 95..328 CDD:214473 70/257 (27%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/259 (28%)
Tryp_SPc 47..282 CDD:214473 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.