DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss43

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:339 Identity:94/339 - (27%)
Similarity:148/339 - (43%) Gaps:72/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SDEEVCCEKSNVIGMSKSPPQH---SVDTLLRTSYPNALDGSPQVFGDQTK-------------- 99
            ||.|...::|.:..:|.|.|..   |||   ||..|.:  |||.  |..||              
Mouse    50 SDPEAPAQQSRLKSLSISHPSGVPVSVD---RTEIPGS--GSPS--GTTTKITLENRRSSLGGPF 107

  Fly   100 -------------------PNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVR 145
                               ..::||..:|.::..::.|||||:...||||||.:  ....:.||.
Mouse   108 FTDTCGHRITEVDPGSLSAGRKWPWQVSLQSQNEHVCGGSLISHRWVLTAAHCI--YEQEEYMVM 170

  Fly   146 AGEWDLSSSEK----LNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLP-I 205
            .|: |:..||.    |.|..|     |:....|:..:..||:||..|..|....:.||.:.|| .
Mouse   171 LGD-DMLHSESESVTLVPVQD-----IIFPSNFDIQTMRNDIALALLYFPVNYSSLIQPVCLPEE 229

  Fly   206 PDKTFDRRICTVAGWGMRSSTD-----VDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPAS 265
            |.:..:..:|.|.|||.::..|     :.:|.:||::.|....::..||||..:|   |..: ..
Mouse   230 PFRVKNGTVCWVTGWGQQNEIDAGFASILLQEVQQRILLQKHCNTLFQRQLGTSK---NLVI-KG 290

  Fly   266 LMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINP 330
            ::|...:.|:.:|....|..|.|..|   |.:.|.||:|:|:.|....|.:.:|.::::.||:: 
Mouse   291 MICGLQDSGQSLCWGDSGNPLVCESD---NTWTQVGIMSWGINCNGVPVLSVYTDIAEYNEWVS- 351

  Fly   331 HLEQVLSVPGNMLP 344
               .|||....|.|
Mouse   352 ---YVLSQASRMDP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 73/276 (26%)
Tryp_SPc 95..328 CDD:214473 72/275 (26%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97 19/53 (36%)
Tryp_SPc 117..351 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.