DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Tpsg1

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:290 Identity:80/290 - (27%)
Similarity:125/290 - (43%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RTSYPNALD---------GSPQV-------FGDQTKP-NQFPWVTALFAKGSYLGGGSLITPGLV 127
            |..||::|.         |.|||       .|....| ..:||..:|.....::.||||::|..|
Mouse    58 RGQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWV 122

  Fly   128 LTAAHILAG-LSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGAN-DLALLFLDS 190
            |||||..:| ::.:|..|..||..::.|     |....|.:|:.:.......|:: |:||:.|.|
Mouse   123 LTAAHCFSGSVNSSDYQVHLGELTVTLS-----PHFSTVKRIIMYTGSPGPPGSSGDIALVQLSS 182

  Fly   191 PFELRANIQTIRLPIPDKTFDRRI-CTVAGWGMRSSTD---------------VDIQTIQQKVDL 239
            |..|.:.:|.:.||.....|...: |.|.|||.....:               ||::|..|..:.
Mouse   183 PVALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNS 247

  Fly   240 PVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVS 304
            |               .||..|  ..::||.|.  .|.|....|..|.|.:   ...::|||:||
Mouse   248 P---------------NGSLIQ--PDMLCARGP--GDACQDDSGGPLVCQV---AGTWQQAGVVS 290

  Fly   305 FGVGCGQANVPTTFTHVSKFMEWINPHLEQ 334
            :|.|||:.:.|..:..|:.::.||:.|:.:
Mouse   291 WGEGCGRPDRPGVYARVTAYVNWIHHHIPE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/252 (28%)
Tryp_SPc 95..328 CDD:214473 69/251 (27%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.