DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG30288

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:107/284 - (37%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAG 136
            ::...|.....|...:||     |........||:..:...|..:.||||||...||||.|.   
  Fly    28 ENDCGTTSSNGYRARIDG-----GRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHC--- 84

  Fly   137 LSPNDIMVRAGEWD-----------LSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDS 190
            :||..:.||.||:|           :.:....|..:||:::         :|:...|:.||.:..
  Fly    85 ISPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIV---------HSNPGYDIGLLRMQR 140

  Fly   191 PFELRANIQTIRLPIPDKTFDRRICTV-----AGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQ 250
            .......::.|.| |..||......::     .|||  :::|.:.|...|...|..:....|:|.
  Fly   141 SVIFSNYVRPICL-ILGKTLGGNPLSILRFNFTGWG--TNSDGEEQDRLQTATLQQLPQWSCERP 202

  Fly   251 LRLTKMGSNYQLPASLMCAG--------GEEGRDVCSL--FGGFALFCSLDDDPNRYEQAGIVSF 305
            .|        .|..|.:|||        |:.|..:.::  |.|          ..|..|.|:.|.
  Fly   203 GR--------PLDISYICAGSYISDSCKGDSGGPLSAIRTFEG----------QGRVFQFGVASQ 249

  Fly   306 GVG-CGQANVPTTFTHVSKFMEWI 328
            |:. |....:.|..||   |.:||
  Fly   250 GLRLCSGLGIYTNVTH---FTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 65/261 (25%)
Tryp_SPc 95..328 CDD:214473 63/259 (24%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 65/268 (24%)
Tryp_SPc 45..270 CDD:238113 64/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.