DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG30287

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:285 Identity:76/285 - (26%)
Similarity:122/285 - (42%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PNALDGSPQVFGDQTKPNQF-------------PWVTALFAKGSYLGGGSLITPGLVLTAAHILA 135
            |:.||  ||....:::|..:             ||:..:..:|....|||||||..||||||..:
  Fly    23 PHLLD--PQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKS 85

  Fly   136 GLSPNDIMVRAGEWDLSSSEKLNP----PMDRQVIKIMEHEAFNYSS-GANDLALLFLDSPFELR 195
            . :.:.:.||.|::|::.:...:.    |..|::.....:...:|:: ..||:|||.|::..:..
  Fly    86 E-TKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYG 149

  Fly   196 ANIQTIRLPIPDKTFDRRIC------TVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLT 254
            .||::|.|.:.|.|:...|.      ...|||...|          :::.||::      |..||
  Fly   150 DNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTES----------RINSPVLQ------QASLT 198

  Fly   255 KMGSNY-------QLPASLMCAGGEEGRDVCSLFGGFALFCSLD-DDPNRYEQAGIVSFG-VGC- 309
            ....:|       ||..|.:|.....| ..|....|..|...:. ....|....|:||:| |.| 
  Fly   199 HHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF 262

  Fly   310 GQANVPTTFTHVSKFMEWINPHLEQ 334
            |    ||.:|:|..|..||..|.::
  Fly   263 G----PTVYTNVIHFANWIELHTKK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 69/267 (26%)
Tryp_SPc 95..328 CDD:214473 68/266 (26%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/257 (26%)
Tryp_SPc 42..280 CDD:238113 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.