DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss42

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:240 Identity:69/240 - (28%)
Similarity:112/240 - (46%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAH-ILAGLSPNDIMVRAGEWDLSSSEKLN 158
            |...:..::||..::..:..::.|||||....|||||| |.:.:..|   |:.|:   .|..:.|
Mouse    82 GVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHCIYSRIQYN---VKVGD---RSVYRQN 140

  Fly   159 PPMDRQVIKIMEHEAFNYSSGA-NDLALLFLDSPFELRANIQTIRLP---IPDKTFDRRICTVAG 219
            ..:...:..|..|..|:.:... ||:|||.|..|.....||..:.:|   .|.|...:  |.|.|
Mouse   141 TSLVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSESFPVKAGTK--CWVTG 203

  Fly   220 WGMRSSTDVDIQT-IQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGG 283
            ||.......|:.| |.|:||..|:...:|...|:.....|...:...::|...|.|:|.|....|
Mouse   204 WGKLVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVKRGMVCGYKERGKDACQGDSG 268

  Fly   284 FALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            ..:.|..:   |::.|.|:||:|:.||:...|..:|.|:.:.:|:
Mouse   269 GPMSCEFE---NKWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 69/240 (29%)
Tryp_SPc 95..328 CDD:214473 68/238 (29%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 68/237 (29%)
Tryp_SPc 79..310 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.