DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and TPSD1

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:225 Identity:69/225 - (30%)
Similarity:101/225 - (44%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ALDGSPQVFGDQTKPNQFPWVTALFAKGSY---LGGGSLITPGLVLTAAHI-------LAGLSPN 140
            ||..:..|.|.:...:::||..:|..:|.|   ..|||||.|..||||||.       ||.|   
Human    32 ALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAAL--- 93

  Fly   141 DIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPI 205
              .|:..|..|...::|.|     |.:|:.|..|.......|:|||.|:.|..:.::|.|:.||.
Human    94 --RVQLREQHLYYQDQLLP-----VSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPP 151

  Fly   206 PDKTFDRRI-CTVAGWGMRSSTDVDIQTIQ-------QKVDLPVVESSKCQRQLRL-TKMGSNYQ 261
            ..:||...: |.|.|||     ||| ..:.       ::|::||||:..|..:... ...|.::|
Human   152 ASETFPPGMPCWVTGWG-----DVD-NNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQ 210

  Fly   262 LPASLMCAGGEEGRDVCSLFGGFALFCSLD 291
            :....|...|.|..|.|....|..|.|.::
Human   211 IVRDDMLCAGSENHDSCQGDSGGPLVCKVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 66/216 (31%)
Tryp_SPc 95..328 CDD:214473 66/216 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 67/219 (31%)
Tryp_SPc 38..240 CDD:214473 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.