DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and F9

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:387 Identity:100/387 - (25%)
Similarity:154/387 - (39%) Gaps:116/387 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SNLCVPRENCREEM-------PF--------FDFSSTIE-------C---SDEEVCCEKSNVIGM 66
            ||.|:...:|::::       ||        .|.:..|:       |   :|.:|.|..:....:
Human    99 SNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRL 163

  Fly    67 SK----------------SPPQHSVDTLLRTSYPNA-----------LDGSPQ-----------V 93
            ::                |..|.|..|...|.:|:.           ||...|           |
Human   164 AENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVV 228

  Fly    94 FGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAH-ILAGLSPNDIMVRAGEWDLSSSEKL 157
            .|:..||.||||...|..|.....|||::....::|||| :..|:.   |.|.|||.::..:|  
Human   229 GGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVK---ITVVAGEHNIEETE-- 288

  Fly   158 NPPMDRQVIKIMEHEAFNYSSGAN----DLALLFLDSPFELRANIQTIRLPIPDKTFDRRICT-- 216
            :....|.||:|:.|.  ||::..|    |:|||.||.|..|.:.:..|  .|.||.:......  
Human   289 HTEQKRNVIRIIPHH--NYNAAINKYNHDIALLELDEPLVLNSYVTPI--CIADKEYTNIFLKFG 349

  Fly   217 ---VAGWGM-----RSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEE 273
               |:|||.     ||:      .:.|.:.:|:|:.:.|   ||.||    :.:..::.|||..|
Human   350 SGYVSGWGRVFHKGRSA------LVLQYLRVPLVDRATC---LRSTK----FTIYNNMFCAGFHE 401

  Fly   274 -GRDVCSLFGGFALFCSLDDDPNRYE------QAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
             |||.|....|         .|:..|      ..||:|:|..|........:|.||:::.||
Human   402 GGRDSCQGDSG---------GPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 78/256 (30%)
Tryp_SPc 95..328 CDD:214473 76/254 (30%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 6/29 (21%)
FXa_inhibition 134..170 CDD:317114 5/35 (14%)
Tryp_SPc 227..457 CDD:238113 79/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.