DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Tpsb2

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:259 Identity:79/259 - (30%)
Similarity:124/259 - (47%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSY---LGGGSLITPGLVLTAAHILAG--LSPNDIMVRAGEWDLS 152
            |.|.:...:::||..:|..|.:|   ..|||||.|..||||||.:..  .||....|:..|..|.
Mouse    33 VGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLY 97

  Fly   153 SSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTF-DRRICT 216
            ..::|     ..:.:|:.|..:..:.|..|:|||.|:.|..:..::..|.||...:|| ....|.
Mouse    98 YGDQL-----LSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCW 157

  Fly   217 VAGWGMRSSTDVDIQTIQ--------QKVDLPVVESSKCQRQLRLTKMGSNYQLPA---SLMCAG 270
            |.|||       ||...:        ::|.:|:||:|.|.|:.. |.:.:....|.   .::|||
Mouse   158 VTGWG-------DIDNDEPLPPPYPLKQVKVPIVENSLCDRKYH-TGLYTGDDFPIVHDGMLCAG 214

  Fly   271 GEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQ 334
            ... ||.|....|..|.|.:   ...:.|||:||:|.||.|.|.|..:|.|:.:::||:.::.:
Mouse   215 NTR-RDSCQGDSGGPLVCKV---KGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 77/250 (31%)
Tryp_SPc 95..328 CDD:214473 76/249 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.