DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG12256

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:122/285 - (42%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IGMSKSPPQHSVDTLLRTSYPNALDGSPQVFG------DQTKPNQFPWVTALF----AKGSYLGG 118
            :|..:|.|..:|..|.:......|:...:|.|      |:..|.|   |:..|    .|..:..|
  Fly    18 LGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQ---VSMQFLTRSGKMRHFCG 79

  Fly   119 GSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSS-GAND 182
            ||||.|..||||||.:.|.:.:.|.|.||..||:.|...     |..::..|... ||.. ..:|
  Fly    80 GSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSGF-----RSQVQSYEMNE-NYQELVTSD 138

  Fly   183 LALLFLDSPFEL-RANIQTIRLPIPDKTFDRRICTVAGWG----MRSSTDVDIQTIQQKVDLPVV 242
            :|:|.:|.|||| ...:.||.:...|.....:...:.|||    ..:.......|:.||:|...:
  Fly   139 IAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTL 203

  Fly   243 ESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGV 307
            .:|||:..:.        ||..:.:||....|:..|:...|..|.....:.   |:|.|:||:|.
  Fly   204 SNSKCKETMT--------QLTDTEICALERFGKGACNGDSGGPLVMKSGES---YKQVGVVSYGT 257

  Fly   308 GCGQANVPTTFTHVSKFMEWINPHL 332
            ....:|.|..:|.||.|..||...:
  Fly   258 AFCASNNPDVYTRVSMFDGWIKERM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 73/249 (29%)
Tryp_SPc 95..328 CDD:214473 72/248 (29%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/251 (29%)
Tryp_SPc 47..280 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.