DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and zgc:165423

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:261 Identity:80/261 - (30%)
Similarity:123/261 - (47%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSYPNALDGSPQ----VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHIL-AGLSPN 140
            |..|.|...:|.    |.|.......:||..:|...||:..|||||:...:|:|||.. :..:|:
Zfish    23 TQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPS 87

  Fly   141 DIMVRAGEWDLSSSEKLNP-PMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLP 204
            |..|..|.   .|.:..|| .:.:.|.:::.|..:..|:..||:|||.|.||......||.:.|.
Zfish    88 DYTVYLGR---QSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLA 149

  Fly   205 IPDKTFDRRICTVAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMC 268
            ....||......:.||| :.|...:....|.|:|::|:|.::.|.     ...|....:..::||
Zfish   150 ADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCN-----CLYGGGSSITNNMMC 209

  Fly   269 AG-GEEGRDVC-SLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPH 331
            || .:.|:|.| ...||..:..|.    |.:.|||:||||.||...|.|..:..||::..||:.:
Zfish   210 AGLMQGGKDSCQGDSGGPMVIKSF----NTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQY 270

  Fly   332 L 332
            :
Zfish   271 V 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 74/238 (31%)
Tryp_SPc 95..328 CDD:214473 73/237 (31%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 74/241 (31%)
Tryp_SPc 38..269 CDD:238113 76/242 (31%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.