DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and zgc:163079

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:296 Identity:86/296 - (29%)
Similarity:135/296 - (45%) Gaps:51/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGS--YLGGG 119
            |..:|:|.|  ::|....:...|     ||..||            :||..::..|.:  :..||
Zfish    20 CLGQSDVCG--RAPLNTKIIGGL-----NATQGS------------WPWQASINLKATEEFYCGG 65

  Fly   120 SLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNP-PMDRQVIKIMEHEAFNYSSGANDL 183
            |||..|.|||.|.:.|.:..:||:|..|....:.|   || .:.|.|.||::|.  ||:|..::|
Zfish    66 SLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGS---NPYEISRTVTKIIKHP--NYNSLDSNL 125

  Fly   184 ALLFLDSPFELRANIQTIRLPIPDKTF-DRRICTVAGWGM--RSST--DVDIQTIQQKVDLPVVE 243
            |||.|.||......|:.:.|......| |.....|.|||.  |.:|  ::.:..:.|:|:.|:|.
Zfish   126 ALLKLSSPVTFSDYIKPVCLAAAGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVN 190

  Fly   244 SSKCQRQLRLTKMGSNYQ--LPASLMCAG--GEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVS 304
            :.:|         .:.|.  :...|:|||  .|:|:..|:...|..|...   ....:.|:|:|.
Zfish   191 NFEC---------NAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIK---QGAIWIQSGVVV 243

  Fly   305 FGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPG 340
            .|. ||....||.:..||::.:||:.:...  |:||
Zfish   244 SGY-CGLPGYPTIYVRVSEYEDWISYYTNS--SLPG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 72/245 (29%)
Tryp_SPc 95..328 CDD:214473 71/244 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 76/265 (29%)
Tryp_SPc 36..267 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.