DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and LOC100004427

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:292 Identity:79/292 - (27%)
Similarity:128/292 - (43%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CCEKSNVIGMSKSPPQHSVDTLLRTSYP---NALDGSPQVFGDQTKPNQFPWVTALFAK--GSYL 116
            |..:|:|.|  ::|        |.|...   ||.:||            :||..::..|  |.:.
Zfish    20 CLGQSDVCG--RAP--------LNTKIVGGLNATEGS------------WPWQASINFKSTGQFF 62

  Fly   117 GGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGAN 181
            ..||||:...|||||.....::.:|:::..|....:.|.....|  |.||::         |...
Zfish    63 CSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTNGSNPYEIP--RTVIQV---------SVTE 116

  Fly   182 DLALLFLDSPFELRANIQTIRLPIPDKTF-DRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESS 245
            |:||:.|.|.......|:.:.|......| |.....|.|||..|||:|.:..:.::|:.|:|.:.
Zfish   117 DIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNI 181

  Fly   246 KCQRQLRLTKMGSNYQLPASLMCAG--GEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVG 308
            :|.....:|.:.       :::|||  .|.|:..|....|..|   :....:::.|:|:|.| ..
Zfish   182 ECSNINGITNLD-------NVICAGFVNETGKAPCWEDFGSPL---VTRQGSQWIQSGVVVF-TF 235

  Fly   309 CGQANVPTTFTHVSKFMEWINPHLEQVLSVPG 340
            |||...||.:..||::.|||..:...  |:||
Zfish   236 CGQNGFPTLYARVSEYEEWIRNYTSS--SLPG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 64/238 (27%)
Tryp_SPc 95..328 CDD:214473 63/237 (27%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 67/253 (26%)
Tryp_SPc 36..257 CDD:238113 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.