DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:253 Identity:76/253 - (30%)
Similarity:120/253 - (47%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GSPQVFGDQTKPNQFPW-VTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRA-----G 147
            |...|.|.:..|..:|| |........::.|||:|....||:|||..    ||...|.|     |
Zfish    29 GKRIVGGVEASPGSWPWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCF----PNPSEVSAYTLYMG 89

  Fly   148 EWDL---SSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKT 209
            ...|   :..||::     .|.:::..|.:....|..|:||:.|.:|......||.:.||..|..
Zfish    90 RHLLNGYNQFEKVS-----YVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQ 149

  Fly   210 FDR-RICTVAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLR-LTKMGSNYQLPASLMCAGG 271
            |:. .:|.|.||| .:....:......::|::|:::.|.||...: |:...|...:.:.::|||.
Zfish   150 FNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMICAGY 214

  Fly   272 EE-GRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            :| |:|.|....|..|.|.:.:  ..:.|||:||||:||.|.|.|..::.||.|.:.|
Zfish   215 KEGGKDSCQGDSGGPLVCPVGN--GTWIQAGVVSFGLGCAQKNRPGIYSRVSSFEKLI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 74/247 (30%)
Tryp_SPc 95..328 CDD:214473 73/245 (30%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.