DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and gzma

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:249 Identity:69/249 - (27%)
Similarity:105/249 - (42%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 WTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIV 161
            |.|::..|. |....|.|:.:..|:||||...| :.:...::.|:..|.         :.:.||.
Zfish    40 WMVSIQVNQ-NHKCGGILIHKEWVLTAAHCKED-SYSSVTVLIGSLSLS---------KGSQRIA 93

  Fly   162 SH----PD-FNKMTGANNIALIVLETSFVMKP--------PIGPICWPTSGVSFDRERCLVAGWG 213
            .|    |: |||.|..::|.||.|......||        .:.|           ..:|:|.|||
Zfish    94 IHNYEIPETFNKKTKKDDIMLIRLSKKVKAKPYKIPKKEKDVQP-----------GTKCVVRGWG 147

  Fly   214 RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSP 277
            ..|:..|..|.|.:.:::.:|.|..|.....|...:..     .:||||. ::.|..|:||.|.|
Zfish   148 TTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITK-----DMLCAGNTQQHRGTCLGDSGGP 207

  Fly   278 LMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNIS--HMRPWIEKQLNDELN 329
            |.|.       ..|||:::....||....|.:||.:|  |: .||.|.|..:.|
Zfish   208 LECE-------KNLVGVLSGSHGCGDPKKPTVYTLLSKRHI-TWINKILKQQFN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/241 (27%)
Tryp_SPc 90..320 CDD:214473 64/238 (27%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.