DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and zgc:153968

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:268 Identity:69/268 - (25%)
Similarity:120/268 - (44%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGKS--NPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFG---AGTLVTENIVITAAHLMLDK 130
            ||::  .|..:||      ..|....:||.|::  :.|...|   .|||:....|::||......
Zfish    27 CGRAPLKPRIIGG------QTAMAGSWPWQVSI--HYIPTGGLLCGGTLINREWVLSAAQCFQKL 83

  Fly   131 TINDFGIIGGAWDLKQLA--GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPI 193
            |.::..:     .|..|:  ...:....|::|::||.::..|..|:|||:.|.|.......|.|:
Zfish    84 TASNLVV-----HLGHLSTGDPNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPV 143

  Fly   194 CWPTSGVSFDRER-CLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPT 257
            |...||.|..:.. ..:.|||..:.....:....:::.:|:||..||:|       .....:...
Zfish   144 CLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKS-------AYGSLITDG 201

  Fly   258 ILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYELV--GIVNSGFSCGLENVPALYTNISHMRPW 319
            ::||| .|.|:..|:||||.||:     |.:..:.:  ||.:.|..|.....|.::|.:|....|
Zfish   202 MICAGPNEGGKGICMGDGGGPLV-----HNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESW 261

  Fly   320 IEKQLNDE 327
            |:.|::.:
Zfish   262 IKSQISKD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/243 (26%)
Tryp_SPc 90..320 CDD:214473 61/238 (26%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 63/251 (25%)
Tryp_SPc 36..265 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.