DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and TPSAB1

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:264 Identity:76/264 - (28%)
Similarity:119/264 - (45%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQAKPNEFPWTVALMQN---LINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGG 140
            :||      .:|..:::||.|:|..:   .::|.| |:|:....|:||||           .:|.
Human    32 VGG------QEAPRSKWPWQVSLRVHGPYWMHFCG-GSLIHPQWVLTAAH-----------CVGP 78

  Fly   141 AWDLKQLAGKTIQWR-----------TATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPIC 194
              |:|.||...:|.|           ..:||:.||.|.......:|||:.||....:...:..:.
Human    79 --DVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVT 141

  Fly   195 WPTSGVSFDRER-CLVAGWGRPD---FLAKNYSYKQKKIDLPIVSRSDCESLLRRTAF----VQS 251
            .|.:..:|.... |.|.|||..|   .|...:..||.|:  ||:....|::.....|:    |:.
Human   142 LPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV--PIMENHICDAKYHLGAYTGDDVRI 204

  Fly   252 FQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHM 316
            .:.|  :||||..| ||:|.||.|.||:|.:.|   .:...|:|:.|..|...|.|.:||.:::.
Human   205 VRDD--MLCAGNTR-RDSCQGDSGGPLVCKVNG---TWLQAGVVSWGEGCAQPNRPGIYTRVTYY 263

  Fly   317 RPWI 320
            ..||
Human   264 LDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 74/255 (29%)
Tryp_SPc 90..320 CDD:214473 72/251 (29%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 76/264 (29%)
Tryp_SPc 31..267 CDD:214473 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.