DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss56

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:281 Identity:83/281 - (29%)
Similarity:125/281 - (44%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PLNCGKSNPNGLGGTVE---EVV--DQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLM 127
            |:.||:.: .|:..|..   .:|  ..|....:||.|.|....:...| |.||..:.|:||||..
Mouse    90 PVQCGERH-QGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCG-GVLVAASWVLTAAHCF 152

  Fly   128 LDKTINDFGIIGGAWDLKQLA----GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKP 188
            ...: |:.     .|.: .||    |:..:.....||:.||.|:..|..|::||:.|.|....:.
Mouse   153 AGAS-NEL-----LWTV-MLAEGPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEG 210

  Fly   189 PIGPICWPTSGVSFDRE-----RCLVAGWGR-----PDFLAKNYSYKQKKIDLPIVSRSDCESLL 243
            |..|||.|..    .||     .|.:||||.     |:      |...::..:|::|...|:.:|
Mouse   211 PARPICLPQG----SREPPAGTPCAIAGWGALFEDGPE------SEAVREARVPLLSADTCQKVL 265

  Fly   244 RRTAFVQSFQLDP-TILCAG---GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLE 304
                   ...|.| |:||||   |  |.|:|.||.|.||.|..||......|.|:.:.|..||..
Mouse   266 -------GPGLRPSTMLCAGYLAG--GIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEP 321

  Fly   305 NVPALYTNISHMRPWIEKQLN 325
            ..|.:||.::..:.|:::|::
Mouse   322 GKPGVYTRVTVFKDWLQEQMS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 76/252 (30%)
Tryp_SPc 90..320 CDD:214473 75/247 (30%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.