DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:277 Identity:69/277 - (24%)
Similarity:109/277 - (39%) Gaps:64/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NCGK------------SNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVIT 122
            :|||            .||...|.             :||.|:|.:|.|:..| |||:....|:|
  Rat   143 DCGKRAIPLIANRIVSGNPAAKGA-------------WPWQVSLQRNNIHQCG-GTLIGNMWVVT 193

  Fly   123 AAH------------LMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNI 175
            |||            |....|||                ..:..|...||:.|..:......::|
  Rat   194 AAHCFRTNANPRQWTLSFGTTIN----------------PPLMKREVRRIIMHEKYRPPARDHDI 242

  Fly   176 ALIVLETSFVMKPPIGPICWPTSGVSF-DRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDC 239
            ||:...........:..||.|....|| ......:.|:|...:..::.: :.::..:.|:|...|
  Rat   243 ALVQFSPRVTFSDEVRRICLPEPSASFPPNSTVYITGFGALYYGGESQN-ELREARVQIISNDVC 306

  Fly   240 ESLLRRTAFVQSFQLDPTILCAGGERG-RDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGL 303
                 :...|...::...:.|||...| .|||.||.|.||:  :......:.|:|||:.|.:||.
  Rat   307 -----KQRHVYGNEIKRGMFCAGFLEGIYDACRGDSGGPLV--VRDDKDTWYLIGIVSWGDNCGQ 364

  Fly   304 ENVPALYTNISHMRPWI 320
            :|.|.:||.:::.|.||
  Rat   365 KNKPGVYTQVTYYRRWI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/247 (26%)
Tryp_SPc 90..320 CDD:214473 61/243 (25%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 66/264 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.