DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and LOC683849

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:253 Identity:72/253 - (28%)
Similarity:121/253 - (47%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDL 144
            |.|.:|       |..|:.|:|  |....|..|:|:.:..|::|||....:    ..:..|..::
  Rat    27 GYTCQE-------NSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCYKSR----IQVRLGEHNI 78

  Fly   145 KQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLV 209
            ..|.|.. |:..|.:|:.||:|::.|..|:|.||.|.:...:...:..:..|:|......: ||:
  Rat    79 NVLEGNE-QFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQ-CLI 141

  Fly   210 AGWG--------RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSF--QLDPTILCAGG- 263
            :|||        .||.|        :.:|.|::.::|||:         |:  ::...::|||. 
  Rat   142 SGWGNTLSFGVNEPDLL--------QCLDAPLLPQADCEA---------SYPGKITDNMVCAGFL 189

  Fly   264 ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIE 321
            |.|:|:|.||.|.|::|.       .||.|||:.|:.|.|.:.|.:||.:.:...|||
  Rat   190 EGGKDSCQGDSGGPVVCN-------GELQGIVSWGYGCALPDNPGVYTKVCNYVDWIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/245 (28%)
Tryp_SPc 90..320 CDD:214473 66/240 (28%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 69/250 (28%)
Tryp_SPc 24..242 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.