DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and zgc:123217

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:270 Identity:69/270 - (25%)
Similarity:116/270 - (42%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGKS--NPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIN 133
            ||.:  |...:|||      .|....:||.|::..|..:..| |||:....|:||||.:::..||
Zfish    28 CGVAPLNTRIVGGT------DAPAGSWPWQVSIHYNNRHICG-GTLIHSQWVMTAAHCIINTNIN 85

  Fly   134 DFGIIGGAWDLKQLAGKTIQWRTATR----------IVSHPDFNKMTGANNIALIVLETSFVMKP 188
                   .|.|  ..|:..|..:...          |:.||.||.....|:|:|:.|........
Zfish    86 -------VWTL--YLGRQTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSL 141

  Fly   189 PIGPICW-PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQ----KKIDLPIVSRSDCESLLRRTAF 248
            .|.|||. ..:.:.::...|...|||.   :.|:.:...    :::.:|:|:.|.|.:   ....
Zfish   142 YIRPICLAANNSIFYNGTSCWATGWGN---IGKDQALPAPQTLQQVQIPVVANSLCST---EYES 200

  Fly   249 VQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFS--CGLENVPALYT 311
            |.:..:.|.::|| |:..:..|.||.|.|..|.   ..:::...||.:.|.|  |.:...|.:|:
Zfish   201 VNNATITPQMICA-GKANKGTCQGDSGGPFQCK---QGSVWIQAGITSYGTSAGCAVGAYPDVYS 261

  Fly   312 NISHMRPWIE 321
            .:|..:.||:
Zfish   262 RVSEFQSWIK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/251 (25%)
Tryp_SPc 90..320 CDD:214473 61/246 (25%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 64/259 (25%)
Tryp_SPc 37..273 CDD:238113 66/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.