DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG34458

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:114/241 - (47%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQW 154
            |.|.:||..|:|..|..:..| |:|:::.:::||||..:.:.......|.|..||....|:|.  
  Fly    38 AAPGQFPHQVSLQLNGRHHCG-GSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTF-- 99

  Fly   155 RTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRE-RCLVAGWGRPDFL 218
             ...:.:.||.:|..:...:::||.|.:...|...:..|....|..::..: ..:::|:|.   :
  Fly   100 -NIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISGFGA---I 160

  Fly   219 AKNYSY--KQKKIDLPIVSRSDCESLLRRTAFVQSFQ-LDPTILCAGGERGR-DACIGDGGSPLM 279
            .:|...  :.|...:.:.||..|.|        |:.. |...::|||...|: .:|.||.|.|| 
  Fly   161 NQNLQLPNRLKFAQVQLWSRDYCNS--------QNIPGLTDRMVCAGHPSGQVSSCQGDSGGPL- 216

  Fly   280 CPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLN 325
             .:.|     :|.|:|:.||.||.:..||:||.:..:|.||::..|
  Fly   217 -TVDG-----KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/237 (27%)
Tryp_SPc 90..320 CDD:214473 62/234 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 62/234 (26%)
Tryp_SPc 32..254 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.