DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:292 Identity:75/292 - (25%)
Similarity:123/292 - (42%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGKS----NPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKT 131
            ||:.    ||..:||.      .|....:||.|:| |.....|..|:|:....|:||||.::|:|
Zfish    25 CGRPNPTLNPRIVGGV------NATHGAWPWMVSL-QGRYGHFCGGSLINNQWVLTAAHCIVDQT 82

  Fly   132 INDFGIIGGAW-----DLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIG 191
            .:...:..|.|     |:..::      ||...|:.||.::.:|..|:|||:.|.::......|.
Zfish    83 PSSIIVYLGKWRSYVADVNSIS------RTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIK 141

  Fly   192 PICWPTSGVSFDR-ERCLVAGWG---------------------RPDFLAKNYSYKQKKIDLPIV 234
            |||......:|.| ....|||||                     .|..|        ::.:|.:.
Zfish   142 PICLADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGIL--------QEAELKVY 198

  Fly   235 SRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACI-GDGGSPLM--CPIPGHPAIYELVGIVN 296
            |.:||.::...       ::.|.::|||...|..|.. ||.|.|||  |      :::...|:::
Zfish   199 SNADCNNICHG-------RITPNMICAGTRPGGKATFSGDSGGPLMTKC------SVWVQAGVLS 250

  Fly   297 SGFSCGLENVPALYTNISHMRPWIEKQLNDEL 328
            .|:.|...|:|.::..:|..:.||...:...|
Zfish   251 HGYGCAQPNLPEVFIRVSEYKQWITGNVGGNL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/264 (26%)
Tryp_SPc 90..320 CDD:214473 66/259 (25%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 68/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D382647at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.