DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:102 Identity:32/102 - (31%)
Similarity:51/102 - (50%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPLM---CPIPGHPAIYEL 291
            :|:|..|||.:||..|       :...::||| .:.|:|.|.||.|.|::   |      :::..
Zfish    21 VPVVINSDCNNLLGAT-------ITDNMMCAGLLQGGKDTCQGDSGGPMVSQQC------SVWVQ 72

  Fly   292 VGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDEL 328
            .||::.|..||....|.:||.:|..:.||...:|..|
Zfish    73 SGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQNL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 30/95 (32%)
Tryp_SPc 90..320 CDD:214473 28/92 (30%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.