DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010618

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001688265.1 Gene:AgaP_AGAP010618 / 5667797 VectorBaseID:AGAP010618 Length:252 Species:Anopheles gambiae


Alignment Length:211 Identity:59/211 - (27%)
Similarity:97/211 - (45%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGA--- 172
            :.::|:.:..:||||.:.        |.||:.|:.: .|...|   ..:|...|::.: ||:   
Mosquito    67 SASIVSGSHALTAAHCVT--------IRGGSSDIFK-GGTLFQ---VVKITVSPNYMR-TGSIAR 118

  Fly   173 ----NNIALIVLET-SFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLP 232
                |::|::.:.| :||.||.|.||.:.||.......||...||||.:| .:|.|.|....:..
Mosquito   119 NVYDNDVAVLTVATNAFVGKPNIAPISFATSAELPSGTRCYALGWGRTNF-DENLSTKLLYAEFK 182

  Fly   233 IVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNS 297
            :|..:||     |.|:.....:.|.::| |..:..:.|.||.|.||:|.       .:|.||...
Mosquito   183 LVLTADC-----RKAYSGKANITPNVIC-GKAKNSEVCEGDSGGPLVCD-------NKLTGITFF 234

  Fly   298 GFSCGLENVPALYTNI 313
            .:......:||.:|.|
Mosquito   235 VYGKCKGILPAGFTKI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 59/211 (28%)
Tryp_SPc 90..320 CDD:214473 59/211 (28%)
AgaP_AGAP010618XP_001688265.1 Tryp_SPc 40..250 CDD:214473 58/209 (28%)
Tryp_SPc 41..252 CDD:238113 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.