DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP005686

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001688706.1 Gene:AgaP_AGAP005686 / 5667393 VectorBaseID:AGAP005686 Length:297 Species:Anopheles gambiae


Alignment Length:249 Identity:66/249 - (26%)
Similarity:117/249 - (46%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QAKPNEFPWTVALMQNLINFFGAGT------LVTENIVITAAHLM--LDKTINDFGI-IGGAWD- 143
            :|.|.:||:.|||:.:    |..||      ::|.|.::||||.:  ....::..|| |.||.: 
Mosquito    62 EALPGQFPYQVALLSD----FPEGTALCGASVLTRNFLLTAAHCISGTGNALSSGGIAIMGAQNR 122

  Fly   144 -LKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWP--TSGVSFDRE 205
             :.:|:.:.|::.| :.|..||.::..:..|::||::|.:.......:.||..|  |....|...
Mosquito   123 MIVELSQQRIRFST-SGIRRHPGYDATSLRNDVALVLLNSRITFTSRVQPIRLPARTDTRQFGGF 186

  Fly   206 RCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAF--VQSFQLDPTILCAGGERGRD 268
            ...|:|:||....::..|...:....|:::.::|   :....|  .||..     :|.....||.
Mosquito   187 TGTVSGFGRTTDSSQATSATLRFTSNPVLTNAEC---ITSWGFGLAQSQN-----VCLKASGGRS 243

  Fly   269 ACIGDGGSPLMCPIPGHPAIYELVGIVN--SGFSCGLENVPALYTNISHMRPWI 320
            ||.||.|.||.....|   :.: :|:|:  |...|. ...|::|..:::..|||
Mosquito   244 ACNGDSGGPLTVDSNG---VLQ-IGVVSFVSAAGCA-SGRPSVYARVTYFLPWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/249 (27%)
Tryp_SPc 90..320 CDD:214473 64/246 (26%)
AgaP_AGAP005686XP_001688706.1 Tryp_SPc 56..292 CDD:214473 64/247 (26%)
Tryp_SPc 57..295 CDD:238113 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.