DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:298 Identity:78/298 - (26%)
Similarity:123/298 - (41%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCGKS--NPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKT 131
            |.||||  .|..:|      |::|..:.:||.|::..:..:..| |:::..:.|:||||.....|
Human   194 LACGKSLKTPRVVG------VEEASVDSWPWQVSIQYDKQHVCG-GSILDPHWVLTAAHCFRKHT 251

  Fly   132 INDFGIIGGAWDLKQLAGKTIQWRTATRIVSHP----------DFNKM-TGANNIALIVLETSFV 185
                    ..::.|..||       :.::.|.|          :||.| ...|:|||:.|:....
Human   252 --------DVFNWKVRAG-------SDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLT 301

  Fly   186 MKPPIGPICWPTSGVSFDRE-----RCLVAGWGRPDFLAKNYSYKQKKI----DLPIVSRSDCES 241
            ....:.|||.|    .||.|     ...:.|||    ..|....|...|    .:.::..:.|.:
Human   302 FSGTVRPICLP----FFDEELTPATPLWIIGWG----FTKQNGGKMSDILLQASVQVIDSTRCNA 358

  Fly   242 LLRRTAFVQSFQLDPT--ILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYE-----LVGIVNSG 298
                   ..::|.:.|  ::||| .|.|.|.|.||.|.|||         |:     :||||:.|
Human   359 -------DDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLM---------YQSDQWHVVGIVSWG 407

  Fly   299 FSCGLENVPALYTNISHMRPWI-----EKQLNDELNKP 331
            :.||..:.|.:||.:|....||     ::.:....|.|
Human   408 YGCGGPSTPGVYTKVSAYLNWIYNVWKDRTIQRSCNSP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/267 (25%)
Tryp_SPc 90..320 CDD:214473 66/257 (26%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 1/2 (50%)
Tryp_SPc 204..429 CDD:214473 68/270 (25%)
Tryp_SPc 205..432 CDD:238113 70/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.