DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and ela3l

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:279 Identity:82/279 - (29%)
Similarity:133/279 - (47%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIGAPLNCGKSNPNGLGGTVEEVV--DQAKPNEFPWTVALM-QNLINFFG--AGTLVTENIVIT 122
            ::|.:...|||.....|   :..||  ::|:|:.:||.|:|. |:..:|:.  .|:::.||.|:|
Zfish     9 VLIASAFGCGKPPIEPL---MSRVVNGEEARPHSWPWQVSLQYQSGSSFYHTCGGSIIAENWVMT 70

  Fly   123 AAHLMLDKTINDFGIIGGAWDL--KQLAGKTIQWRTATRIVSHPDFNKMTGA--NNIALIVLETS 183
            |||.:  .:..::.::.|..||  .:...:||   :|.:|:.|..:|.|..|  |:||||.|...
Zfish    71 AAHCI--SSGRNYRVLVGKHDLSVNEEGSQTI---SAQKIIVHEKWNSMFVALGNDIALIKLAEP 130

  Fly   184 FVMKPPIGPICWPTSG-VSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCE 240
            ..:...|...|.|..| |..:...|.::||||       ||.|       |:.: :|.|..:.|.
Zfish   131 VTLSDTIQLGCVPAPGDVLPNNYPCYISGWGRLSTGGALPDRL-------QQAL-MPAVDHATCS 187

  Fly   241 SLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVN--SGFSCGL 303
            ......:.|:.     |::||||:.....|.||.|.||.|  .....|:|:.||.:  ||..|..
Zfish   188 RFDWWGSSVKE-----TMVCAGGDGVVAGCNGDSGGPLNC--KNSDGIWEVHGIASFVSGLGCNT 245

  Fly   304 ENVPALYTNISHMRPWIEK 322
            ...|.::|.:|....|::|
Zfish   246 IRKPTVFTRVSSFTDWVDK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 75/252 (30%)
Tryp_SPc 90..320 CDD:214473 73/246 (30%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.