DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and zgc:112038

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:277 Identity:78/277 - (28%)
Similarity:127/277 - (45%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 APLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQ-NLINFFGAGTLVTENIVITAAH-LMLD 129
            ||||      |..||      |.|....:||..::.: :..:....|:|:.::.|::||| .|:.
Zfish    30 APLN------NNNGG------DDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMIT 82

  Fly   130 KTINDFGIIGGAWDLKQLAGKTIQW--------RTATRIVSHPDFNKMTGANNIALIVLETSFVM 186
            .|.|          :|...|:..|.        ||.|:||.|||::..|..|:|||:.|.:|...
Zfish    83 ATAN----------IKIFLGRQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTF 137

  Fly   187 KPPIGPICWPTSGVSF-DRERCLVAGWGR---PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTA 247
            ...|.|:|..::...| ...:..:.||.:   .|....|.   .:::.||:||.::|.:..:.. 
Zfish   138 TDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNV---LQEVQLPVVSNTECNADYKGI- 198

  Fly   248 FVQSFQLDPTILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYT 311
                  :...::||| .|.|:|||.||.|.|:   :..:.:.:...|||:.|..|||...|.:||
Zfish   199 ------ITDNMICAGINEGGKDACQGDSGGPM---VSQNGSRWIQSGIVSFGRECGLPRYPGIYT 254

  Fly   312 NISHMRPWIEKQLNDEL 328
            .:|..:.||..:|...|
Zfish   255 RVSQYQSWITSELRTNL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/249 (28%)
Tryp_SPc 90..320 CDD:214473 66/244 (27%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 69/254 (27%)
Tryp_SPc 37..263 CDD:238113 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.