DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss44

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:309 Identity:80/309 - (25%)
Similarity:132/309 - (42%) Gaps:85/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SWPSPCQRSESCCHSSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFF 109
            |:|.....:.:|.|.:.::|.|.|                     |...::||.|:|..:..:..
  Rat    95 SFPPWIPPTSACGHRTARIVGGKP---------------------APIRKWPWQVSLQVHKQHIC 138

  Fly   110 GAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTAT------RIVSHPDFNK 168
            | |:|:::..|:||||.:....  |:.:..|..||         |.:.:      .|:.|.|::.
  Rat   139 G-GSLISKWWVMTAAHCVYGHL--DYVVSMGEADL---------WSSMSVKIPVQDIIVHQDYSV 191

  Fly   169 M-TGANNIALIVL----------------ETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPD 216
            | |..::|||::|                |.||:::|  |.:||             |.|||:..
  Rat   192 MRTIVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQP--GTLCW-------------VTGWGKTI 241

  Fly   217 FLAKNYSYKQKKIDLPIVSRSDCESLL-----RRTAFVQSFQLDPTILCAGGERGRDACIGDGGS 276
            ...:: |...:::||.|:....|..:|     |....||...     :|...::|.|||.||.|.
  Rat   242 ERGRS-SRVLREVDLSIIRHERCNQILKDITGRIFTLVQEGG-----VCGYNKKGGDACQGDSGG 300

  Fly   277 PLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLN 325
            |::|..   ...:..||||:.|..||....|.:||.:|:.|.||.|:|:
  Rat   301 PMVCEF---NKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWIIKELS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 71/262 (27%)
Tryp_SPc 90..320 CDD:214473 69/257 (27%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 72/285 (25%)
Tryp_SPc 113..341 CDD:238113 72/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.