DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP012671

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001230557.2 Gene:AgaP_AGAP012671 / 4578478 VectorBaseID:AGAP012671 Length:216 Species:Anopheles gambiae


Alignment Length:240 Identity:55/240 - (22%)
Similarity:91/240 - (37%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TLVTENIVITAAHLMLDKTINDF--GIIGGAWDLKQLAGKTIQWRTATRIVSHPDF--------- 166
            |::|....:||||.:..:.....  .:.||:  ...:.|..:  .:..||..||.:         
Mosquito    13 TIITHKHALTAAHCVYPQRSEPMRVSLYGGS--TSAVTGGVL--FSVVRIAVHPGYDHSYFPDAS 73

  Fly   167 -----------NKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAK 220
                       |..:|.:|:|.::|:||   :.|||             .||.||||||......
Mosquito    74 EYDVAVLTVANNAFSGKSNMASLILQTS---EQPIG-------------TRCFVAGWGRTGNNEP 122

  Fly   221 NYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGR--DACIGDGGSPLMCPIP 283
            ....:.:..::.||.:|.|         .:::...|.......:.|.  |.|.||.|..|:|.  
Mosquito   123 ASLNQLRYAEMTIVDQSTC---------ARAWATYPRQRVTSKKYGNGVDTCKGDSGGALVCG-- 176

  Fly   284 GHPAIYELVGIVN-SGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
                 ..|.|:|: :...| ....||.::.||  .|.|.:.::.|
Mosquito   177 -----GGLAGVVSFTNLEC-TSAWPAGFSKIS--APSIRRFISTE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 54/234 (23%)
Tryp_SPc 90..320 CDD:214473 53/231 (23%)
AgaP_AGAP012671XP_001230557.2 Tryp_SPc 11..203 CDD:214473 52/228 (23%)
Tryp_SPc 11..202 CDD:238113 50/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.