DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:331 Identity:80/331 - (24%)
Similarity:129/331 - (38%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIFIRCCFWTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPL 69
            ::.:..|.         ..:|:...||        |...||:.|.....|:.  .|.::|.|.|.
Mosquito     5 IVVVLACL---------AAVQVRLPPQ--------NAREISYQSIVPFREAT--RSSRIVNGFPA 50

  Fly    70 NCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGA----GTLVTENIVITAAHLMLDK 130
            :.|                     :||:.|.|:.:     |:    |:|::...|:||||..:. 
Mosquito    51 SLG---------------------QFPYQVFLIGD-----GSLACGGSLISAEWVLTAAHCQVG- 88

  Fly   131 TINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICW 195
             |:.|.:..|:  ::..:|.|:  ||:..|:.||::|.....|:|.||.|.....:...|..:..
Mosquito    89 -ISQFTVRAGS--IQNNSGGTV--RTSNLIIIHPNYNPSNLNNDIGLIRLNEPMPLGGNIQVVAL 148

  Fly   196 PTSGVS--FDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTI 258
            |.:.:|  |......|:|:||....:...|.....:.|.|:|...|.........:.|      .
Mosquito   149 PEANLSETFLNREATVSGFGRTSDASGAISPNLNFVHLNIISNIQCMGTYGSATIIDS------T 207

  Fly   259 LCAGGERGRDA-----CIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLE-NVPALYTNISHMR 317
            :||   .||||     |.||.|.||.....|...   .:|:|:...:.|.| ..|:.|...:|.|
Mosquito   208 VCA---VGRDAPNQGTCNGDSGGPLTVTENGQSV---QIGVVSFVAAAGCEVGFPSGYVRTTHFR 266

  Fly   318 PWIEKQ 323
            .||..|
Mosquito   267 NWIRDQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 65/246 (26%)
Tryp_SPc 90..320 CDD:214473 63/241 (26%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 67/269 (25%)
Tryp_SPc 44..272 CDD:238113 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.