DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:270 Identity:62/270 - (22%)
Similarity:102/270 - (37%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLA 148
            |.|.:.....:.|||..|..:...|..|.:|::|..|:|.||.:.::.:....:.....|.:.:.
Mosquito     5 ESVANNGTLGQLPWTALLKTSSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKKDCDEQGVC 69

  Fly   149 GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWG 213
            ....|.....|.::|..|:.....|:|||:.|..:......:.|||.|.:               
Mosquito    70 TLAPQDIPVERAIAHDGFSARRKLNDIALVRLAQNVSFNNDVLPICLPVA--------------- 119

  Fly   214 RPDF--LAKNY-------SYKQKKIDL-------PIVSRSDCES----LLRRTAFVQSFQLDPTI 258
             |::  ...||       .|.....|.       |:.: .:||:    |::|...:|...:    
Mosquito   120 -PEYQPAGSNYFTARDGQDYASLNTDTISITEVHPLTT-ENCENRLQELIKRQHKIQESHI---- 178

  Fly   259 LCAGGERGR-DACIGDGGSPLMCPIPGHPAIYEL-----VGIVNSGF-SCGLENVPALYTNISHM 316
              .|.|.|. |.|....|.||:       |:...     .|:|:.|. .|.|||||::||.:...
Mosquito   179 --CGYEAGSFDGCATSAGGPLV-------ALDRFGRNVQHGVVSYGVQDCSLENVPSVYTRVESF 234

  Fly   317 RPWIEKQLND 326
            ..||...|.:
Mosquito   235 INWILHNLEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 59/261 (23%)
Tryp_SPc 90..320 CDD:214473 57/256 (22%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 57/253 (23%)
Tryp_SPc 14..238 CDD:238113 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.