DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP008995

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001238187.2 Gene:AgaP_AGAP008995 / 4578167 VectorBaseID:AGAP008995 Length:237 Species:Anopheles gambiae


Alignment Length:87 Identity:17/87 - (19%)
Similarity:29/87 - (33%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLNCGKSNPNG 78
            |:|.|........|..|..:..||..:....|.....::.:.....::|     |.|...::.:.
Mosquito    10 TVTSTAGALAATTESTPSSVSSTSEGSTPTSSTTMKPKKKKKRPSGNKK-----PSNATTTSSSS 69

  Fly    79 LGGTVEEVVDQAKPNEFPWTVA 100
            ..||       .||...|..:|
Mosquito    70 SSGT-------KKPTAKPTVLA 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 4/13 (31%)
Tryp_SPc 90..320 CDD:214473 4/11 (36%)
AgaP_AGAP008995XP_001238187.2 DUF4551 <96..>187 CDD:291746
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.