DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP011040

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001237041.2 Gene:AgaP_AGAP011040 / 4577547 VectorBaseID:AGAP011040 Length:284 Species:Anopheles gambiae


Alignment Length:229 Identity:67/229 - (29%)
Similarity:100/229 - (43%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 INFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATR---IVSHPDFN 167
            |.|...|:|:.|:.|:||||.|.:....:..::....|...:..|..::....:   |:.||.:|
Mosquito    45 IEFGCGGSLILESFVLTAAHCMDNPNTLERPLVVRLGDRNLIHSKDSEYAQEIKIRDIIPHPKYN 109

  Fly   168 KMTGANNIALIVLETSFVMKPP-----IGPIC-WPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQ 226
            :.|...:|||:||:     ||.     :.|.| |....:.|  .....||||...|..|..:|..
Mosquito   110 RATSHFDIALLVLD-----KPARRVFGVIPACLWLEDELLF--STLYAAGWGANGFDKKPTNYLV 167

  Fly   227 KKIDLPIVSRSDCESLLRRTAFVQSFQLDPTI----LCAGGERGRDACIGDGGSPLMCPIP-GHP 286
            ..:..| |:..:|...|:|.  |...:|...|    |||.|.. .|.|.||.|.||...:. .:.
Mosquito   168 TAVLQP-VTNEECIDKLKRQ--VPRMKLANGISDHQLCAAGIE-MDTCKGDSGGPLYSKLNFANK 228

  Fly   287 AIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            .:..|||:.:.|..||... |.:|..:|..|.||
Mosquito   229 LVPFLVGLTSYGGPCGFSQ-PGVYVRVSKFRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 67/229 (29%)
Tryp_SPc 90..320 CDD:214473 65/227 (29%)
AgaP_AGAP011040XP_001237041.2 Tryp_SPc 49..264 CDD:238113 65/225 (29%)
Tryp_SPc 49..261 CDD:214473 63/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.