DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CLIPB19

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001237510.1 Gene:CLIPB19 / 4577378 VectorBaseID:AGAP003247 Length:367 Species:Anopheles gambiae


Alignment Length:315 Identity:79/315 - (25%)
Similarity:135/315 - (42%) Gaps:59/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SPCQRSES----CCHS---SQKLVIGAPLNCG-KSNPNGLGGTVEEVVDQAKPNEFPWTVALMQ- 103
            |.|...|.    ||..   .::..:.:|.:|| ::|...:|....::      :::||| ||:: 
Mosquito    76 SRCSMHERQPWVCCAGPPPDEQNPLPSPPHCGVRTNTRLIGSQFTQL------DDYPWT-ALIEY 133

  Fly   104 ----NLINFFGAGTLVTENIVITAAHLM--LDKTINDFGIIGGAWDLKQLAGKTIQW-------R 155
                ....|...|||:.:..::||||.:  |.......|:..|.|||.:.....:.:       .
Mosquito   134 EKPDGSTGFHCGGTLINQGHILTAAHCVSTLPAGWKVHGVRLGEWDLSEALDCELNYCNNAPVDL 198

  Fly   156 TATRIVSHPDFNKMTG--ANNIALIVLETSFVMKPPIGPICWP----------TSGVSFDRERCL 208
            ..::|:.|..::.:.|  :::||||..|........|.|||.|          |.|:|      .
Mosquito   199 KISKIMIHEGYDALNGSSSHDIALIRFEQQVNFSDTIKPICLPLAESIRSKNMTDGIS------T 257

  Fly   209 VAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCA-GGERGRDACIG 272
            |.|||:....|.  ..|:.|::|.:.....|.:|     ||:..::.|:.||| ..|...:.|..
Mosquito   258 VVGWGKSQSSAG--VPKRLKLNLNVRDYRVCSAL-----FVRPEEVQPSQLCALREESNNELCSA 315

  Fly   273 DGGSPLMCPIPGHPAIYELVGIVNSG-FSCGLENVPALYTNISHMRPWIEKQLND 326
            |.|:.|.....|   ...|.||..|| ..||..|:|.|:.:::....||::::.:
Mosquito   316 DSGAGLERFFYG---FQYLTGIAGSGEHKCGRGNIPGLFVSVADYVEWIQEKVRE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/262 (26%)
Tryp_SPc 90..320 CDD:214473 67/257 (26%)
CLIPB19XP_001237510.1 CLIP 36..89 CDD:288855 3/12 (25%)
Tryp_SPc 113..361 CDD:214473 68/270 (25%)
Tryp_SPc 115..364 CDD:238113 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.