DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:309 Identity:79/309 - (25%)
Similarity:126/309 - (40%) Gaps:80/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SQKLVIG-----APLN----------CGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLIN 107
            :.|::.|     ||::          ||:.|...  :||....|      ||||| :|.:.....
Mosquito    48 NMKMIFGGGSNRAPIHDTPSSACSCRCGERNDASRIVGGQATGV------NEFPW-MARLSYFNR 105

  Fly   108 FFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAW-DLKQLAGKTIQW----RTATRIVSH---P 164
            |:..|.|:.:..|:||||.          :.|..| .:|...|:..:.    |..||.|..   .
Mosquito   106 FYCGGMLINDRYVLTAAHC----------VKGFMWFMIKVTFGEHNRCDDSVRPETRFVLRAIAQ 160

  Fly   165 DFNKMTGANNIALIVLETSFVMKPPIGPICWP---------TSGVSFDRERCLVAGW------GR 214
            .|:.:...|:|||:.|.....:...|.|||.|         |:|.:        .||      |:
Mosquito   161 KFSFLNFDNDIALLRLNDRVPITDFIRPICLPSDPSNAYVGTNGTA--------TGWGTLKEDGK 217

  Fly   215 PDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG--GERGRDACIGDGGSP 277
            |..:.       :::::|::|...|.:....||.:    :...:||||  |...:|:|.||.|.|
Mosquito   218 PSCIL-------QEVEVPVLSNEVCSTQTNYTASM----ITDNMLCAGYLGVGEKDSCQGDSGGP 271

  Fly   278 LMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLND 326
            |:.  ......|||:|:|:.|..|.....|.:||.::....||.:...|
Mosquito   272 LIA--EREDKRYELIGVVSWGNGCARPYYPGVYTRVTRYLDWIRENSKD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/259 (26%)
Tryp_SPc 90..320 CDD:214473 66/254 (26%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 69/267 (26%)
Tryp_SPc 83..315 CDD:238113 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.