DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP005587

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001237684.2 Gene:AgaP_AGAP005587 / 4576204 VectorBaseID:AGAP005587 Length:296 Species:Anopheles gambiae


Alignment Length:243 Identity:56/243 - (23%)
Similarity:93/243 - (38%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIN--------DFGIIGGAWDLKQLAG 149
            |..||..:::|.      ||:|:|.|.::|:|.::....:.        :.|...||...:|   
Mosquito    86 NPKPWESSIVQT------AGSLITPNYILTSAEVLRKNILGNGKTYGFVELGYRNGADRERQ--- 141

  Fly   150 KTIQWRTATRIVSHPDFNKMTGA--NNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGW 212
            :.|.: |.:.|..||.|   :|.  .|||.|.||....:...:.||..|.  :|.:|...::.|.
Mosquito   142 QVIDF-TNSSISIHPRF---SGGLFYNIATIRLEHPATLNRYVQPIRLPR--LSDNRTFEMMEGT 200

  Fly   213 GRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGE-----RGRDACIG 272
            .    |..:|:...:.:...::...:|  ||:......||        .||.     .|....:.
Mosquito   201 S----LGHHYNGTMRYMRNQVLPHDNC--LLQEYVCTNSF--------IGGAFCNRVDGAGLTVE 251

  Fly   273 DGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            |...|:            |:|.....:.|.| |...:.|.:|..|.||
Mosquito   252 DEDGPI------------LIGFTMRVYWCDL-NERDINTRVSVYRDWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 56/243 (23%)
Tryp_SPc 90..320 CDD:214473 54/241 (22%)
AgaP_AGAP005587XP_001237684.2 Tryp_SPc 54..286 CDD:214473 54/241 (22%)
Tryp_SPc 66..289 CDD:304450 56/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.