DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP005593

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001237686.2 Gene:AgaP_AGAP005593 / 4576200 VectorBaseID:AGAP005593 Length:289 Species:Anopheles gambiae


Alignment Length:226 Identity:52/226 - (23%)
Similarity:87/226 - (38%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWR-----TATRIVSHPDFNKMT 170
            ||:|:|...|:|.| ..|.:.:|:|||......|..|.....||.     |...|.:||.:...:
Mosquito    80 AGSLITLKYVLTTA-ACLYRWVNEFGIEYSFVTLGSLFNGDTQWEQRINFTDNGIHTHPLYRYPS 143

  Fly   171 -GANNIALIVLETSFVMKPPIGPICWP--TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLP 232
             ...|||.|.|:....:...:.||..|  |...:::    ::.|....|...:...|.:.:    
Mosquito   144 YELYNIATIRLDCPATLNRFVQPIRLPRLTDMRTYE----MMEGTATGDSFVRGLKYLRNQ---- 200

  Fly   233 IVSRSDCESLLRRTAFVQSFQLDPTI--LCAGGERGRDACIGDGGSPLMCPIPGHPAIYE----- 290
            ::|..||:..:.....:       |:  ||.....|...|..:.||.|        .:.:     
Mosquito   201 VMSNKDCQRDILPGVVI-------TVQHLCTNSFIGGVFCFREYGSSL--------TVEDENGRF 250

  Fly   291 LVGIVNSGFSCGLENVPALYTNISHMRPWIE 321
            |:||.:..|.|. ...|..:..:|:...||:
Mosquito   251 LIGIADHVFWCS-SKYPTRHVRVSYFVDWIQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 52/226 (23%)
Tryp_SPc 90..320 CDD:214473 50/223 (22%)
AgaP_AGAP005593XP_001237686.2 Tryp_SPc 52..282 CDD:238113 52/226 (23%)
Tryp_SPc 52..279 CDD:214473 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.