DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and pafah1b3

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001006715.1 Gene:pafah1b3 / 448360 XenbaseID:XB-GENE-485956 Length:226 Species:Xenopus tropicalis


Alignment Length:44 Identity:13/44 - (29%)
Similarity:23/44 - (52%) Gaps:7/44 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CCHSSQ---KLVIGAPLNCGKSNPNGLGG---TVEEVVDQAKPN 93
            |.:..|   |:::.|.|..|| |||.|..   .|.:::::..|:
 Frog   124 CIYQRQPQAKVIVMALLPRGK-NPNPLRNRNLQVNKLLEETLPS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 1/6 (17%)
Tryp_SPc 90..320 CDD:214473 1/4 (25%)
pafah1b3NP_001006715.1 PAF_acetylesterase_like 8..217 CDD:238858 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.