powered by:
Protein Alignment CG18557 and pafah1b3
DIOPT Version :9
Sequence 1: | NP_608721.1 |
Gene: | CG18557 / 33483 |
FlyBaseID: | FBgn0031470 |
Length: | 343 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006715.1 |
Gene: | pafah1b3 / 448360 |
XenbaseID: | XB-GENE-485956 |
Length: | 226 |
Species: | Xenopus tropicalis |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 23/44 - (52%) |
Gaps: | 7/44 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 CCHSSQ---KLVIGAPLNCGKSNPNGLGG---TVEEVVDQAKPN 93
|.:..| |:::.|.|..|| |||.|.. .|.:::::..|:
Frog 124 CIYQRQPQAKVIVMALLPRGK-NPNPLRNRNLQVNKLLEETLPS 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.