DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP012566

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001230550.2 Gene:AgaP_AGAP012566 / 4397709 VectorBaseID:AGAP012566 Length:282 Species:Anopheles gambiae


Alignment Length:225 Identity:62/225 - (27%)
Similarity:97/225 - (43%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GTLVTENIVITAAHLMLD--------KTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNK 168
            |.:....:||:.:|.:..        ..|....:.||:.. ....|.:.|   .|||..||:||.
Mosquito    72 GQIRCSAVVISLSHALTGADAVYPYRNNIQRLTLYGGSTS-PTSGGFSFQ---LTRIAVHPNFNP 132

  Fly   169 MTGAN--NIALIVLET-SFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKID 230
            .:|.:  |||::.:.| ||..|..|.||...::||:.. .:|.|.|||:........:...:..|
Mosquito   133 NSGVSDFNIAVLTVPTNSFGGKRNIAPISLASAGVAIG-TKCSVFGWGKTSVNLSGPANTLRSAD 196

  Fly   231 LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIV 295
            :.|.|.:.|..|..:.    ..::...::||.|:||.|.|.||.|:.|:|.       ..|.|:.
Mosquito   197 MIITSEATCARLWAQF----GVKITSNMVCAKGDRGADLCTGDYGNALVCS-------GRLTGVA 250

  Fly   296 NSGFSCGLENVPALYTNI--SHMRPWIEKQ 323
            ....:|| ......||.|  |.:|.:|..|
Mosquito   251 ILSNTCG-NGRDTAYTKITASSVRSFIRSQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 61/223 (27%)
Tryp_SPc 90..320 CDD:214473 60/220 (27%)
AgaP_AGAP012566XP_001230550.2 Tryp_SPc 50..276 CDD:214473 60/220 (27%)
Tryp_SPc 51..279 CDD:304450 61/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.