DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP012491

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001230277.2 Gene:AgaP_AGAP012491 / 4397584 VectorBaseID:AGAP012491 Length:272 Species:Anopheles gambiae


Alignment Length:316 Identity:72/316 - (22%)
Similarity:119/316 - (37%) Gaps:98/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVA 100
            |:|..||....||         ||. ::|.|.|:|.  ||                     :..|
Mosquito    20 TNANGQNTTEGPS---------HSG-RIVNGIPVNI--SN---------------------YKYA 51

  Fly   101 LMQNLINFFGAG-TLVTENIVITAAHLMLDKTIN------------------DFGIIGGAWDLKQ 146
            |.......|..| :::|.:..:||||.:.:....                  :|.::|||     
Mosquito    52 LSMRFDGEFICGASIITYSHALTAAHCVYNYQFMSSRLTLYGGSTSASSGGVEFPVVGGA----- 111

  Fly   147 LAGKTIQWRTATRIVSHPDFNKMTGAN----NIALI-VLETSFVMKPPIGPICWPTSGVSFDRER 206
                           .||.:...:.:|    ::|:: |...||..:|.:.|:...|..:... .|
Mosquito   112 ---------------IHPYYKPNSQSNTSDYDVAILNVPANSFSGRPNMAPLALQTKELPVG-TR 160

  Fly   207 CLVAGWGRPDFLAKNYSYKQKKI---DLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRD 268
            |.|.||||   ..:|......::   ::.|||:|.|.|:...  |.:.......::||....|.|
Mosquito   161 CFVVGWGR---TGENQPVSTNQLLYANMNIVSQSSCASMWAN--FEKLCAECKHMVCAQYYNGMD 220

  Fly   269 ACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSC-GLENVPALYTNIS--HMRPWIE 321
            .|.||.|..|:|.       ..|.|:|:.|..| |:  .|:::..::  .||.:|:
Mosquito   221 TCRGDSGGALVCG-------GRLTGVVSFGPYCSGV--WPSVFAKVTAPSMRSFIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 58/264 (22%)
Tryp_SPc 90..320 CDD:214473 57/259 (22%)
AgaP_AGAP012491XP_001230277.2 Tryp_SPc 36..266 CDD:214473 63/287 (22%)
Tryp_SPc 37..267 CDD:238113 63/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.