DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG9737

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:423 Identity:106/423 - (25%)
Similarity:164/423 - (38%) Gaps:141/423 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CFW---TLTETGAPCGLQME-----CVPQGLCKTSAWNQNAISWPS---------PC----QRSE 54
            ||:   .|.|....|.:..|     |:....||.....:||.:.|:         .|    |.||
  Fly    14 CFYRFLALAEVLQECDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSE 78

  Fly    55 S--------CCHSS--------------------------------QKLVIGAP------LN-CG 72
            :        ||.::                                :::....|      || ||
  Fly    79 AQGSYESLVCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECG 143

  Fly    73 KSNPNGL-GGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFG 136
            |...|.: ||.:.|:      :||||...|:.|..::..:|.|:.:..::||||.:..:.:.|  
  Fly   144 KQVTNRIYGGEIAEL------DEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRD-- 200

  Fly   137 IIGGAWDLKQLAGKTIQWRTA---------------------TRIVSHPDFNKMTG--ANNIALI 178
                ...||.:.......:|.                     .:|..||::.:.:.  .|:||:|
  Fly   201 ----RQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAII 261

  Fly   179 VLE-----TSFVMKPPIGPICWP--------TSGVSFDRERCLVAGWGRPDFLAKNY----SYKQ 226
            .|:     |.|||     |||.|        ..|..|.     |:||||.|...|.:    |..:
  Fly   262 RLKHPVSFTHFVM-----PICLPNKSEPLTLAEGQMFS-----VSGWGRTDLFNKYFINIHSPIK 316

  Fly   227 KKIDLPIVSRSDCESLLRRTAFVQSF--QLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIY 289
            .|:.:|.||..:|      |..::.|  :|.|..:|||||..:|.|.||.|.|||.....| :.:
  Fly   317 LKLRIPYVSNENC------TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQH-SRW 374

  Fly   290 ELVGIVNSGFS-CGLENVPALYTNISHMRPWIE 321
            ...|:|:.||: ||:...||:|||::....||:
  Fly   375 VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWID 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 78/277 (28%)
Tryp_SPc 90..320 CDD:214473 76/272 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 12/60 (20%)
Tryp_SPc 149..406 CDD:214473 79/285 (28%)
Tryp_SPc 150..409 CDD:238113 81/287 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.