DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG11836

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:291 Identity:78/291 - (26%)
Similarity:125/291 - (42%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCGKSNPNGLGGTVEEV-----------------------VDQAKP---NEFPWTVALMQNLIN 107
            ::.|.||..||..|.:||                       :...||   |::||...::.: ..
  Fly    56 ISSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYD-GK 119

  Fly   108 FFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGA 172
            |...|:|:|::.|::|||.:.....:...:|.|..|.:..:......|..|.::.|..|:..|..
  Fly   120 FHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYN 184

  Fly   173 NNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKID 230
            |:|||:.|.........|.|||.|............|.||||       |..:        .::.
  Fly   185 NDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGELPSIV--------NQVK 241

  Fly   231 LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIV 295
            :||:|.::|     |....:|.::..::||| |....|:|.||.|.||:.   .:...|.:||||
  Fly   242 VPIMSITEC-----RNQRYKSTRITSSMLCA-GRPSMDSCQGDSGGPLLL---SNGVKYFIVGIV 297

  Fly   296 NSGFSCGLENVPALYTNISHMRPWIEKQLND 326
            :.|..||.|..|.:|:.:|...|||:..|.:
  Fly   298 SWGVGCGREGYPGVYSRVSKFIPWIKSNLEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/244 (28%)
Tryp_SPc 90..320 CDD:214473 67/239 (28%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.