DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG14892

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:432 Identity:84/432 - (19%)
Similarity:135/432 - (31%) Gaps:166/432 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QMEC---VPQGLCKTSAWNQNAISWPSPCQRSESC-CHSSQ---KLVIGAPLNCGKSNPNGLGGT 82
            |.:|   :|.....|.:|....:..||..|....| |..::   :::.||..|.|          
  Fly    36 QSQCHWQIPATSTATLSWLCLLLLLPSSRQFETDCGCRPARRGPRIIAGAATNEG---------- 90

  Fly    83 VEEVVDQAKPNEFPW--TVALMQNLINFFG---AGTLVTENIVITAAHLMLDKTIN-----DFGI 137
                       :|||  ::.|:...:.|.|   ...|:.:..:::|||.:.:...|     .:.:
  Fly    91 -----------QFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTV 144

  Fly   138 IGGAWDLKQLAGKTIQWRTATRIVSHPDFNK---------------MTGANNIALIVL------- 180
            :.|..|....:|.. |.....:||.|..::.               :|.|:||..|.|       
  Fly   145 VLGEHDRDVESGNE-QRIPVEKIVMHHRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAES 208

  Fly   181 ---ETSFVMKPPIGP---------------------------------ICWPT------------ 197
               ..|..:.||...                                 :..|:            
  Fly   209 PDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSR 273

  Fly   198 --------SGVSFDRER-------------------------------------CLVAGWGRPDF 217
                    |..|..|.|                                     |:..|||:.: 
  Fly   274 MRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKAN- 337

  Fly   218 LAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG---GERGRDACIGDGGSPLM 279
            ::.:.|.:..|..:|:.....|     |.|:.....:....||||   ||.|  .|:||.|.||.
  Fly   338 ISGDLSNQLLKTQVPLHQNGRC-----RDAYGSFVNIHGGHLCAGKLNGEGG--TCVGDSGGPLQ 395

  Fly   280 CPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIE 321
            |.: .....:.|||:.:.|..|.||..|.:||..|:...|||
  Fly   396 CRL-SRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 70/362 (19%)
Tryp_SPc 90..320 CDD:214473 67/357 (19%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 71/385 (18%)
Tryp_SPc 81..438 CDD:238113 74/387 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.