DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Sb

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:281 Identity:83/281 - (29%)
Similarity:124/281 - (44%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLVIGAPLNCG-----KSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFG-------AGTL 114
            |.:..|...||     :.....:||      ..|....:||.|::.:.  :|||       .|.|
  Fly   523 KTISAARSECGVPTLARPETRIVGG------KSAAFGRWPWQVSVRRT--SFFGFSSTHRCGGAL 579

  Fly   115 VTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKT--IQWRTATRIVSHPDFNKMTGANNIAL 177
            :.||.:.||.|.:.|..|:...|..|.:|...:..:.  |:...|.::| ||.::.:|...::||
  Fly   580 INENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVV-HPKYSFLTYEYDLAL 643

  Fly   178 IVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVS 235
            :.||......|.:.|||.|.:..........|.||||       |..|        :::.:||||
  Fly   644 VKLEQPLEFAPHVSPICLPETDSLLIGMNATVTGWGRLSEGGTLPSVL--------QEVSVPIVS 700

  Fly   236 RSDCESLLRRTAFVQSFQLDPTILCAGGER-GRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF 299
            ..:|:|:..| |..|.| :....||||.|. |:|:|.||.|.||..  ......:.|.||::.|.
  Fly   701 NDNCKSMFMR-AGRQEF-IPDIFLCAGYETGGQDSCQGDSGGPLQA--KSQDGRFFLAGIISWGI 761

  Fly   300 SCGLENVPALYTNISHMRPWI 320
            .|...|:|.:.|.||...|||
  Fly   762 GCAEANLPGVCTRISKFTPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/250 (31%)
Tryp_SPc 90..320 CDD:214473 75/246 (30%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 77/259 (30%)
Tryp_SPc 544..785 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.