DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and ea

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:350 Identity:92/350 - (26%)
Similarity:142/350 - (40%) Gaps:76/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLNCGKSNPNGLG 80
            ::.|...|..:.|.|....::|:   .....|.|...|.|        ::..|..||....|.:.
  Fly    76 SQCGYTNGKVLICCPDRYRESSS---ETTPPPKPNVTSNS--------LLPLPGQCGNILSNRIY 129

  Fly    81 GTVEEVVDQAKPNEFPWTVALM-----QNLINFFGAGTLVTENIVITAAHLMLDKTI-NDFGIIG 139
            |.::..:|     |||| :||:     |........|:|::...||||:|.:..|.: .|:.:.|
  Fly   130 GGMKTKID-----EFPW-MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSG 188

  Fly   140 ---GAWDLKQLAGKTIQWR------------TATRIVSHPDF-----NKMTGANNIALIVLETSF 184
               |.||........:..|            ...|.:.|||:     |::   |:|||:.|....
  Fly   189 VRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQV---NDIALLRLAQQV 250

  Fly   185 VMKPPIGPICWPTS----GVSFDRERCLVAGWGRPDFL-AKNYSYKQK----KIDLPIVSRSDCE 240
            .....:.|||.|..    ..:||.....|||||:.:.| |.|...|..    ::|       :|:
  Fly   251 EYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMD-------ECQ 308

  Fly   241 SLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHP-----AIYELVGIVNSG-F 299
            ::...    |...|:.|.:||||:.|.|:|.||.|.||:    |..     ..|.|.|:|:.| .
  Fly   309 NVYSS----QDILLEDTQMCAGGKEGVDSCRGDSGGPLI----GLDTNKVNTYYFLAGVVSFGPT 365

  Fly   300 SCGLENVPALYTNISHMRPWIEKQL 324
            .|||...|.:||.:.....||:..:
  Fly   366 PCGLAGWPGVYTLVGKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 78/275 (28%)
Tryp_SPc 90..320 CDD:214473 75/270 (28%)
eaNP_524362.2 CLIP 37..89 CDD:288855 2/12 (17%)
Tryp_SPc 127..386 CDD:214473 77/282 (27%)
Tryp_SPc 128..389 CDD:238113 79/284 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.