DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG8870

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:371 Identity:98/371 - (26%)
Similarity:143/371 - (38%) Gaps:117/371 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIG----------APL---- 69
            ||.|....|||  .|.|              |.|:.:..:||:|.:||          .|.    
  Fly    23 GAGCQFDTECV--NLDK--------------CPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETY 71

  Fly    70 ----NCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALM--------QNLINFFGAGTLVTENIVIT 122
                .||:|......|.:..:      |||||...|:        |.|:...| |:|:....|:|
  Fly    72 LPHDTCGQSRRKPTKGKIPAL------NEFPWMAMLLYGNKNNLSQKLVPKCG-GSLINNWYVLT 129

  Fly   123 AAHLM----LD-----KTIN----------DFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNK 168
            |||.:    :|     ||:.          |..|:.|.   :|.|...::.. ..:|::|..||:
  Fly   130 AAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGR---RQYAPLYMEIE-VDQIITHEQFNR 190

  Fly   169 MTG---ANNIALIVLETSFVMKPPIGPICWP-TSGVSFDRERCLVAGWGRPD------------- 216
              |   .|:|||:.|:........|.|||.| ...::..:.:...:||  ||             
  Fly   191 --GRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGW--PDMGQGIASEVLLRS 251

  Fly   217 FLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLM-C 280
            |:|:.:         |.|.:|:.:           |.|...| ||||..|.|...||.|.||| .
  Fly   252 FIAERH---------PDVCKSNYD-----------FNLGSQI-CAGGLDGNDTSPGDSGGPLMET 295

  Fly   281 PIPGHPAIYELVGIVNSGFS-CGLENV-PALYTNISHMRPWIEKQL 324
            .|.|...:....||::.|.. |.|:.. ||.||..|:...||:.:|
  Fly   296 VIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/281 (27%)
Tryp_SPc 90..320 CDD:214473 75/276 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 77/276 (28%)
Tryp_SPc 93..337 CDD:214473 75/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.